Lineage for d2hlfd2 (2hlf D:107-210)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2028190Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2028422Species Mouse (Mus musculus) [TaxId:10090] [88567] (358 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 2028850Domain d2hlfd2: 2hlf D:107-210 [136567]
    Other proteins in same PDB: d2hlfa1, d2hlfb1, d2hlfd1, d2hlff1
    automatically matched to d1dqdl2
    complexed with br; mutant

Details for d2hlfd2

PDB Entry: 2hlf (more details), 3.3 Å

PDB Description: structure of the escherichis coli clc chloride channel y445e mutant and fab complex
PDB Compounds: (D:) Fab fragment, light chain

SCOPe Domain Sequences for d2hlfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hlfd2 b.1.1.2 (D:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d2hlfd2:

Click to download the PDB-style file with coordinates for d2hlfd2.
(The format of our PDB-style files is described here.)

Timeline for d2hlfd2: