Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (317 PDB entries) Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region |
Domain d2hlfd2: 2hlf D:107-210 [136567] Other proteins in same PDB: d2hlfa1, d2hlfb1, d2hlfd1, d2hlff1 automatically matched to d1dqdl2 complexed with br; mutant |
PDB Entry: 2hlf (more details), 3.3 Å
SCOPe Domain Sequences for d2hlfd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hlfd2 b.1.1.2 (D:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d2hlfd2:
View in 3D Domains from other chains: (mouse over for more information) d2hlfa1, d2hlfb1, d2hlff1, d2hlff2 |