Lineage for d2hleb1 (2hle B:31-168)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 661366Family b.6.1.5: Ephrin ectodomain [74874] (2 proteins)
    eukaryotic signaling domain probably related to cupredoxins but lacking the metal-binding site
  6. 661372Protein Ephrin-b2 ectodomain [74875] (1 species)
  7. 661373Species Mouse (Mus musculus) [TaxId:10090] [74876] (3 PDB entries)
  8. 661375Domain d2hleb1: 2hle B:31-168 [136565]
    automatically matched to d1ikop_

Details for d2hleb1

PDB Entry: 2hle (more details), 2.05 Å

PDB Description: structural and biophysical characterization of the ephb4-ephrinb2 protein protein interaction and receptor specificity.
PDB Compounds: (B:) ephrin-b2

SCOP Domain Sequences for d2hleb1:

Sequence, based on SEQRES records: (download)

>d2hleb1 b.6.1.5 (B:31-168) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]}
ivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqad
rctikkentpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegldn
qeggvcqtramkilmkvg

Sequence, based on observed residues (ATOM records): (download)

>d2hleb1 b.6.1.5 (B:31-168) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]}
ivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvqyeyykvymvdkdqadr
ctikpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegldnqeggv
cqtramkilmkvg

SCOP Domain Coordinates for d2hleb1:

Click to download the PDB-style file with coordinates for d2hleb1.
(The format of our PDB-style files is described here.)

Timeline for d2hleb1: