SCOP 1.73: Domain d2hleb1: 2hle B:31-168

Lineage for d2hleb1 (2hle B:31-168)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.5: Ephrin ectodomain [74874] (2 proteins)
   eukaryotic signaling domain probably related to cupredoxins but lacking the metal-binding site

6. Protein Ephrin-b2 ectodomain [74875] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [74876] (3 PDB entries)

8. Domain d2hleb1: 2hle B:31-168 [136565]
   automatically matched to d1ikop_

Details for d2hleb1

PDB Entry: 2hle, 2.05 Å

PDB Description: structural and biophysical characterization of the ephb4-ephrinb2 protein protein interaction and receptor specificity.

PDB Compounds: (B:) ephrin-b2

SCOP Domain Sequences for d2hleb1:

Sequence, based on SEQRES records:

>d2hleb1 b.6.1.5 (B:31-168) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]}
ivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqad
rctikkentpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegldn
qeggvcqtramkilmkvg

Sequence, based on observed residues (ATOM records):

>d2hleb1 b.6.1.5 (B:31-168) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]}
ivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvqyeyykvymvdkdqadr
ctikpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegldnqeggv
cqtramkilmkvg

Timeline for d2hleb1:

• d2hleb1 is new in SCOP 1.73
  
• d2hleb1 appears in SCOP 1.75
  
• d2hleb1 appears in the current release, SCOPe 2.08, called d2hleb_