Lineage for d2hleb_ (2hle B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772145Family b.6.1.5: Ephrin ectodomain [74874] (3 proteins)
    eukaryotic signaling domain probably related to cupredoxins but lacking the metal-binding site
    automatically mapped to Pfam PF00812
  6. 2772151Protein Ephrin-b2 ectodomain [74875] (2 species)
  7. 2772152Species Human (Homo sapiens) [TaxId:9606] [190026] (4 PDB entries)
  8. 2772153Domain d2hleb_: 2hle B: [136565]
    Other proteins in same PDB: d2hlea1, d2hlea2
    automated match to d1ikop_

Details for d2hleb_

PDB Entry: 2hle (more details), 2.05 Å

PDB Description: structural and biophysical characterization of the ephb4-ephrinb2 protein protein interaction and receptor specificity.
PDB Compounds: (B:) ephrin-b2

SCOPe Domain Sequences for d2hleb_:

Sequence, based on SEQRES records: (download)

>d2hleb_ b.6.1.5 (B:) Ephrin-b2 ectodomain {Human (Homo sapiens) [TaxId: 9606]}
ivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqad
rctikkentpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegldn
qeggvcqtramkilmkvg

Sequence, based on observed residues (ATOM records): (download)

>d2hleb_ b.6.1.5 (B:) Ephrin-b2 ectodomain {Human (Homo sapiens) [TaxId: 9606]}
ivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvqyeyykvymvdkdqadr
ctikpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegldnqeggv
cqtramkilmkvg

SCOPe Domain Coordinates for d2hleb_:

Click to download the PDB-style file with coordinates for d2hleb_.
(The format of our PDB-style files is described here.)

Timeline for d2hleb_: