SCOPe 2.08: Domain d2hl6b_: 2hl6 B:

Lineage for d2hl6b_ (2hl6 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.17: Fungal lipases [53558] (5 proteins)

6. Protein Feruloyl esterase A [102631] (1 species)
   Triacylglycerol lipase homologue

7. Species Aspergillus niger [TaxId:5061] [102632] (5 PDB entries)
   Uniprot O42807 23-281

8. Domain d2hl6b_: 2hl6 B: [136562]
   automated match to d1uwca_
   complexed with cxs, edo, so4

Details for d2hl6b_

PDB Entry: 2hl6, 1.55 Å

PDB Description: structure of homologously expressed ferrulate esterase of aspergillus niger in complex with caps

PDB Compounds: (B:) feruloyl esterase a

SCOPe Domain Sequences for d2hl6b_:

Sequence; same for both SEQRES and ATOM records:

>d2hl6b_ c.69.1.17 (B:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]}
astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
pettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqgg
qgvndahttyfgmtsgactw

Timeline for d2hl6b_:

• d2hl6b_ first appeared in SCOP 1.73, called d2hl6b1
  
• d2hl6b_ appears in SCOPe 2.07