Lineage for d2hl5b1 (2hl5 B:194-249)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651661Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 651662Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 651663Family a.245.1.1: EB1 dimerisation domain-like [140613] (1 protein)
    Pfam PF03271
  6. 651664Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (1 species)
  7. 651665Species Human (Homo sapiens) [TaxId:9606] [140615] (6 PDB entries)
  8. 651674Domain d2hl5b1: 2hl5 B:194-249 [136560]
    automatically matched to 1WU9 A:191-249
    complexed with cl; mutant

Details for d2hl5b1

PDB Entry: 2hl5 (more details), 1.93 Å

PDB Description: Crystal structure of the C-terminal domain of human EB1 in complex with the A49M mutant CAP-Gly domain of human Dynactin-1 (p150-Glued)
PDB Compounds: (B:) Microtubule-associated protein RP/EB family member 1

SCOP Domain Sequences for d2hl5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hl5b1 a.245.1.1 (B:194-249) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
aelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyat

SCOP Domain Coordinates for d2hl5b1:

Click to download the PDB-style file with coordinates for d2hl5b1.
(The format of our PDB-style files is described here.)

Timeline for d2hl5b1: