Lineage for d2hkqa_ (2hkq A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351135Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 2351136Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 2351137Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
    Pfam PF03271
  6. 2351138Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (3 species)
  7. 2351139Species Human (Homo sapiens) [TaxId:9606] [140615] (12 PDB entries)
    Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254
  8. 2351141Domain d2hkqa_: 2hkq A: [136557]
    Other proteins in same PDB: d2hkqb_
    automated match to d1yiga1

Details for d2hkqa_

PDB Entry: 2hkq (more details), 1.86 Å

PDB Description: Crystal structure of the C-terminal domain of human EB1 in complex with the CAP-Gly domain of human Dynactin-1 (p150-Glued)
PDB Compounds: (A:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d2hkqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hkqa_ a.245.1.1 (A:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
eaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatde
gfvi

SCOPe Domain Coordinates for d2hkqa_:

Click to download the PDB-style file with coordinates for d2hkqa_.
(The format of our PDB-style files is described here.)

Timeline for d2hkqa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hkqb_