SCOP 1.75: Domain d2hkqa1: 2hkq A:192-249

Lineage for d2hkqa1 (2hkq A:192-249)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
   dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices

4. Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family)

5. Family a.245.1.1: EB1 dimerisation domain-like [140613] (1 protein)
   Pfam PF03271

6. Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140615] (6 PDB entries)
   Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254

8. Domain d2hkqa1: 2hkq A:192-249 [136557]
   automatically matched to 1WU9 A:191-249

Details for d2hkqa1

PDB Entry: 2hkq, 1.86 Å

PDB Description: Crystal structure of the C-terminal domain of human EB1 in complex with the CAP-Gly domain of human Dynactin-1 (p150-Glued)

PDB Compounds: (A:) Microtubule-associated protein RP/EB family member 1

SCOP Domain Sequences for d2hkqa1:

Sequence; same for both SEQRES and ATOM records:

>d2hkqa1 a.245.1.1 (A:192-249) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
eaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyat

Timeline for d2hkqa1:

• d2hkqa1 first appeared in SCOP 1.73
  
• d2hkqa1 is called d2hkqa_ in SCOPe 2.01
  
• d2hkqa1 appears in the current release, SCOPe 2.08, called d2hkqa_