Lineage for d2hkja3 (2hkj A:10-228)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732553Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 732554Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 732648Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (6 proteins)
  6. 732687Protein Topoisomerase VI-B subunit [82778] (1 species)
    contains an H2TH domain inserted after this domain and before the second family-specific domain
  7. 732688Species Archaeon Sulfolobus shibatae [TaxId:2286] [82779] (7 PDB entries)
  8. 732689Domain d2hkja3: 2hkj A:10-228 [136555]
    Other proteins in same PDB: d2hkja1, d2hkja2
    automatically matched to d1mx0a3
    complexed with dms, mg, rdc

Details for d2hkja3

PDB Entry: 2hkj (more details), 2 Å

PDB Description: Topoisomerase VI-B bound to radicicol
PDB Compounds: (A:) Type II DNA topoisomerase VI subunit B

SCOP Domain Sequences for d2hkja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]}
lspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitidliddarqi
ykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqmhqdkpiei
etspvnskriytfklkidinknepiivergsventrgfhgtsvaisipgdwpkaksriye
yikrtyiitpyaefifkdpegnvtyyprltnkipkppqe

SCOP Domain Coordinates for d2hkja3:

Click to download the PDB-style file with coordinates for d2hkja3.
(The format of our PDB-style files is described here.)

Timeline for d2hkja3: