Lineage for d2hkja1 (2hkj A:229-306)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348330Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2348331Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2348463Family a.156.1.3: Topoisomerase VI-B subunit middle domain [81705] (1 protein)
    automatically mapped to Pfam PF05833
  6. 2348464Protein Topoisomerase VI-B subunit middle domain [81706] (1 species)
  7. 2348465Species Sulfolobus shibatae [TaxId:2286] [81707] (7 PDB entries)
  8. 2348466Domain d2hkja1: 2hkj A:229-306 [136553]
    Other proteins in same PDB: d2hkja2, d2hkja3
    automated match to d2hkja1
    complexed with dms, mg, rdc

Details for d2hkja1

PDB Entry: 2hkj (more details), 2 Å

PDB Description: Topoisomerase VI-B bound to radicicol
PDB Compounds: (A:) Type II DNA topoisomerase VI subunit B

SCOPe Domain Sequences for d2hkja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hkja1 a.156.1.3 (A:229-306) Topoisomerase VI-B subunit middle domain {Sulfolobus shibatae [TaxId: 2286]}
vkphpygvdreeikilinnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknl
teeeitrlvetfkkyedf

SCOPe Domain Coordinates for d2hkja1:

Click to download the PDB-style file with coordinates for d2hkja1.
(The format of our PDB-style files is described here.)

Timeline for d2hkja1: