Lineage for d2hkia2 (2hki A:153-315)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915719Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1915720Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1915721Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1915812Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1915943Species Spinach (Spinacia oleracea) [TaxId:3562] [69769] (8 PDB entries)
    Uniprot P19866
  8. 1915956Domain d2hkia2: 2hki A:153-315 [136552]
    Other proteins in same PDB: d2hkia1
    automatically matched to d1nboa2
    complexed with so4

Details for d2hkia2

PDB Entry: 2hki (more details), 3 Å

PDB Description: Crystal structure of photosynthetic glyceraldehyde-3-phosphate dehydrogenase A4 isoform
PDB Compounds: (A:) Glyceraldehyde-3-phosphate dehydrogenase A, chloroplast

SCOPe Domain Sequences for d2hkia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hkia2 d.81.1.1 (A:153-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
cttnclapfvkvldqkfgiikgtmttthsytgdqrlldashrdlrraraaclnivptstg
aakavalvlpnlkgklngialrvptpnvsvvdlvvqvskktfaeevnaafresadnelkg
ilsvcdeplvsidfrctdvsstidssltmvmgddmvkviawyd

SCOPe Domain Coordinates for d2hkia2:

Click to download the PDB-style file with coordinates for d2hkia2.
(The format of our PDB-style files is described here.)

Timeline for d2hkia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hkia1