SCOPe 2.05: Domain d2hkia1: 2hki A:1-152,A:316-335

Lineage for d2hkia1 (2hki A:1-152,A:316-335)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (8 PDB entries)
   Uniprot P19866

8. Domain d2hkia1: 2hki A:1-152,A:316-335 [136551]
   Other proteins in same PDB: d2hkia2
   automatically matched to d1nboa1
   complexed with so4

Details for d2hkia1

PDB Entry: 2hki, 3 Å

PDB Description: Crystal structure of photosynthetic glyceraldehyde-3-phosphate dehydrogenase A4 isoform

PDB Compounds: (A:) Glyceraldehyde-3-phosphate dehydrogenase A, chloroplast

SCOPe Domain Sequences for d2hkia1:

Sequence; same for both SEQRES and ATOM records:

>d2hkia1 c.2.1.3 (A:1-152,A:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
itapgkgdiptyvvgvneegythadtiisnasXnewgysqrvvdladivankw

Timeline for d2hkia1:

• d2hkia1 first appeared in SCOP 1.73
  
• d2hkia1 appears in SCOPe 2.04
  
• d2hkia1 appears in SCOPe 2.06
  
• d2hkia1 appears in the current release, SCOPe 2.08