Lineage for d2hkia1 (2hki A:1-152,A:316-335)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2843784Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)
  7. 2843929Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (8 PDB entries)
    Uniprot P19866
  8. 2843942Domain d2hkia1: 2hki A:1-152,A:316-335 [136551]
    Other proteins in same PDB: d2hkia2
    automatically matched to d1nboa1
    complexed with so4

Details for d2hkia1

PDB Entry: 2hki (more details), 3 Å

PDB Description: Crystal structure of photosynthetic glyceraldehyde-3-phosphate dehydrogenase A4 isoform
PDB Compounds: (A:) Glyceraldehyde-3-phosphate dehydrogenase A, chloroplast

SCOPe Domain Sequences for d2hkia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hkia1 c.2.1.3 (A:1-152,A:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
itapgkgdiptyvvgvneegythadtiisnasXnewgysqrvvdladivankw

SCOPe Domain Coordinates for d2hkia1:

Click to download the PDB-style file with coordinates for d2hkia1.
(The format of our PDB-style files is described here.)

Timeline for d2hkia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hkia2