![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species) |
![]() | Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (8 PDB entries) Uniprot P19866 |
![]() | Domain d2hkia1: 2hki A:1-152,A:316-335 [136551] Other proteins in same PDB: d2hkia2 automatically matched to d1nboa1 complexed with so4 |
PDB Entry: 2hki (more details), 3 Å
SCOPe Domain Sequences for d2hkia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hkia1 c.2.1.3 (A:1-152,A:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl itapgkgdiptyvvgvneegythadtiisnasXnewgysqrvvdladivankw
Timeline for d2hkia1: