![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Haemopoetic cell kinase Hck [56151] (1 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56152] (4 PDB entries) |
![]() | Domain d2hk5a1: 2hk5 A:230-497 [136549] automatically matched to d1qcfa3 complexed with 1bm |
PDB Entry: 2hk5 (more details), 2 Å
SCOP Domain Sequences for d2hk5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hk5a1 d.144.1.7 (A:230-497) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} qkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveaflaea nvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqia egmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwtap eainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeel ynimmrcwknrpeerptfeyiqsvlddf
Timeline for d2hk5a1: