Lineage for d2hk5a2 (2hk5 A:230-497)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543873Protein Haemopoetic cell kinase Hck [56151] (1 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 2543874Species Human (Homo sapiens) [TaxId:9606] [56152] (24 PDB entries)
  8. 2543890Domain d2hk5a2: 2hk5 A:230-497 [136549]
    Other proteins in same PDB: d2hk5a3
    automated match to d2ofua_
    complexed with 1bm

Details for d2hk5a2

PDB Entry: 2hk5 (more details), 2 Å

PDB Description: hck kinase in complex with lck targetted inhibitor pg-1009247
PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d2hk5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hk5a2 d.144.1.7 (A:230-497) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
qkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveaflaea
nvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqia
egmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwtap
eainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeel
ynimmrcwknrpeerptfeyiqsvlddf

SCOPe Domain Coordinates for d2hk5a2:

Click to download the PDB-style file with coordinates for d2hk5a2.
(The format of our PDB-style files is described here.)

Timeline for d2hk5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hk5a3