SCOPe 2.05: Domain d2hjsa2: 2hjs A:130-319

Lineage for d2hjsa2 (2hjs A:130-319)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Usg-1 protein homolog PA3116 [143542] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [143543] (1 PDB entry)
   Uniprot O87014 130-319

8. Domain d2hjsa2: 2hjs A:130-319 [136548]
   Other proteins in same PDB: d2hjsa1
   complexed with dio

Details for d2hjsa2

PDB Entry: 2hjs, 2.2 Å

PDB Description: The structure of a probable aspartate-semialdehyde dehydrogenase from Pseudomonas aeruginosa

PDB Compounds: (A:) USG-1 protein homolog

SCOPe Domain Sequences for d2hjsa2:

Sequence; same for both SEQRES and ATOM records:

>d2hjsa2 d.81.1.1 (A:130-319) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]}
cavaaelcevlapllatldcrqlnltaclsvsslgregvkelarqtaellnarpleprlf
drqiafnllaqvgavdaeghsaierrifaevqallgerigplnvtciqapvffgdslsvt
lqcaepvdlaavtrvldatkgiewvgegdyptvvgdalgqdetyvgrvragqadpcqvnl
wivsdnvrkg

Timeline for d2hjsa2:

• d2hjsa2 first appeared in SCOP 1.73
  
• d2hjsa2 appears in SCOPe 2.04
  
• d2hjsa2 appears in SCOPe 2.06
  
• d2hjsa2 appears in the current release, SCOPe 2.08