![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
![]() | Protein Usg-1 protein homolog PA3116 [143542] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [143543] (1 PDB entry) Uniprot O87014 130-319 |
![]() | Domain d2hjsa2: 2hjs A:130-319 [136548] Other proteins in same PDB: d2hjsa1 complexed with dio |
PDB Entry: 2hjs (more details), 2.2 Å
SCOPe Domain Sequences for d2hjsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hjsa2 d.81.1.1 (A:130-319) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} cavaaelcevlapllatldcrqlnltaclsvsslgregvkelarqtaellnarpleprlf drqiafnllaqvgavdaeghsaierrifaevqallgerigplnvtciqapvffgdslsvt lqcaepvdlaavtrvldatkgiewvgegdyptvvgdalgqdetyvgrvragqadpcqvnl wivsdnvrkg
Timeline for d2hjsa2: