Lineage for d2hjsa1 (2hjs A:3-129,A:320-336)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2451891Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2452497Protein Usg-1 protein homolog PA3116 [141923] (1 species)
  7. 2452498Species Pseudomonas aeruginosa [TaxId:287] [141924] (1 PDB entry)
    Uniprot O87014 3-129,320-336
  8. 2452499Domain d2hjsa1: 2hjs A:3-129,A:320-336 [136547]
    Other proteins in same PDB: d2hjsa2
    complexed with dio

Details for d2hjsa1

PDB Entry: 2hjs (more details), 2.2 Å

PDB Description: The structure of a probable aspartate-semialdehyde dehydrogenase from Pseudomonas aeruginosa
PDB Compounds: (A:) USG-1 protein homolog

SCOPe Domain Sequences for d2hjsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]}
qplnvavvgatgsvgealvgllderdfplhrlhllasaesagqrmgfaesslrvgdvdsf
dfssvglaffaaaaevsrahaeraraagcsvidlsgalepsvappvmvsvnaerlasqaa
pfllsspXaalnavllgellikhyl

SCOPe Domain Coordinates for d2hjsa1:

Click to download the PDB-style file with coordinates for d2hjsa1.
(The format of our PDB-style files is described here.)

Timeline for d2hjsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hjsa2