SCOPe 2.06: Domain d2hjka2: 2hjk A:1-181

Lineage for d2hjka2 (2hjk A:1-181)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (23 PDB entries)

8. Domain d2hjka2: 2hjk A:1-181 [136542]
   Other proteins in same PDB: d2hjka1, d2hjkb_
   automatically matched to d1a1ma2

Details for d2hjka2

PDB Entry: 2hjk, 1.85 Å

PDB Description: Crystal Structure of HLA-B5703 and HIV-1 peptide

PDB Compounds: (A:) HLA class I histocompatibility antigen B-57

SCOPe Domain Sequences for d2hjka2:

Sequence; same for both SEQRES and ATOM records:

>d2hjka2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprmaprapwieqegpeyw
dgetrnmkasaqtyrenlrialryynqseagshiiqvmygcdvgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqiiqrkweaarvaeqlrayleglcvewlrrylengketlq
r

Timeline for d2hjka2:

• d2hjka2 first appeared in SCOP 1.73
  
• d2hjka2 appears in SCOPe 2.05
  
• d2hjka2 appears in SCOPe 2.07
  
• d2hjka2 appears in the current release, SCOPe 2.08