Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88605] (157 PDB entries) Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor |
Domain d2hjka1: 2hjk A:182-274 [136541] Other proteins in same PDB: d2hjka2, d2hjkb_ automatically matched to d1a1ma1 |
PDB Entry: 2hjk (more details), 1.85 Å
SCOPe Domain Sequences for d2hjka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hjka1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf qkwaavvvpsgeeqrytchvqheglpkpltlrw
Timeline for d2hjka1: