Lineage for d2hjfc_ (2hjf C:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) (S)
    Pfam PF00520
  5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. Protein automated matches [190184] (3 species)
    not a true protein
  7. Species Streptomyces lividans [TaxId:1916] [186922] (11 PDB entries)
  8. Domain d2hjfc_: 2hjf C: [136540]
    Other proteins in same PDB: d2hjfa1, d2hjfa2, d2hjfa3, d2hjfb1, d2hjfb2
    automated match to d1k4cc_
    complexed with k, tba

Details for d2hjfc_

PDB Entry: 2hjf (more details), 2.9 Å

PDB Description: Potassium channel kcsa-fab complex with tetrabutylammonium (TBA)
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2hjfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hjfc_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d2hjfc_ are not available.

Timeline for d2hjfc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hjfa1, d2hjfa2, d2hjfa3, d2hjfb1, d2hjfb2