Lineage for d2hj9a_ (2hj9 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2161445Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2161446Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2161447Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 2161659Protein Quorum-sensing signal (autoinducer-2) binding protein LuxP [69622] (1 species)
  7. 2161660Species Vibrio harveyi [TaxId:669] [69623] (6 PDB entries)
  8. 2161669Domain d2hj9a_: 2hj9 A: [136538]
    Other proteins in same PDB: d2hj9c1, d2hj9d_
    automated match to d1jx6a_
    complexed with ai2

Details for d2hj9a_

PDB Entry: 2hj9 (more details), 2.34 Å

PDB Description: Crystal structure of the Autoinducer-2-bound form of Vibrio harveyi LuxP complexed with the periplasmic domain of LuxQ
PDB Compounds: (A:) Autoinducer 2-binding periplasmic protein luxP

SCOPe Domain Sequences for d2hj9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hj9a_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]}
gywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywvrni
asfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrkfveh
vldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysvlyf
segyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiyacst
dvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeaikwd
ledkpvptvysgdfeivtkadsperiealkkrafrysdn

SCOPe Domain Coordinates for d2hj9a_:

Click to download the PDB-style file with coordinates for d2hj9a_.
(The format of our PDB-style files is described here.)

Timeline for d2hj9a_: