![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins) |
![]() | Protein Quorum-sensing signal (autoinducer-2) binding protein LuxP [69622] (1 species) |
![]() | Species Vibrio harveyi [TaxId:669] [69623] (3 PDB entries) |
![]() | Domain d2hj9a1: 2hj9 A:27-364 [136538] automatically matched to d1jx6a_ complexed with ai2 |
PDB Entry: 2hj9 (more details), 2.34 Å
SCOP Domain Sequences for d2hj9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hj9a1 c.93.1.1 (A:27-364) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]} gywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywvrni asfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrkfveh vldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysvlyf segyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiyacst dvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeaikwd ledkpvptvysgdfeivtkadsperiealkkrafrysd
Timeline for d2hj9a1: