Lineage for d2hj6m_ (2hj6 M:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632594Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2632595Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2632596Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2632815Protein automated matches [190224] (14 species)
    not a true protein
  7. 2632838Species Rhodobacter sphaeroides [TaxId:1063] [186985] (32 PDB entries)
  8. 2632891Domain d2hj6m_: 2hj6 M: [136537]
    Other proteins in same PDB: d2hj6h1, d2hj6h2
    automated match to d2j8dm_
    complexed with bcl, bph, cdl, fe, gol, hto, k, lda, po4, ps2, u10

Details for d2hj6m_

PDB Entry: 2hj6 (more details), 3 Å

PDB Description: reaction centre from rhodobacter sphaeroides strain r-26.1 complexed with dibrominated phosphatidylserine
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d2hj6m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hj6m_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

SCOPe Domain Coordinates for d2hj6m_:

Click to download the PDB-style file with coordinates for d2hj6m_.
(The format of our PDB-style files is described here.)

Timeline for d2hj6m_: