Lineage for d2hj6l_ (2hj6 L:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1958788Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1958789Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1958790Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1958970Protein automated matches [190224] (7 species)
    not a true protein
  7. 1958986Species Rhodobacter sphaeroides [TaxId:1063] [186985] (32 PDB entries)
  8. 1959041Domain d2hj6l_: 2hj6 L: [136536]
    Other proteins in same PDB: d2hj6h1, d2hj6h2
    automated match to d1qovl_
    complexed with bcl, bph, cdl, fe, gol, hto, k, lda, po4, ps2, u10

Details for d2hj6l_

PDB Entry: 2hj6 (more details), 3 Å

PDB Description: reaction centre from rhodobacter sphaeroides strain r-26.1 complexed with dibrominated phosphatidylserine
PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d2hj6l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hj6l_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d2hj6l_:

Click to download the PDB-style file with coordinates for d2hj6l_.
(The format of our PDB-style files is described here.)

Timeline for d2hj6l_: