Lineage for d2hiqb1 (2hiq B:9-104)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723747Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 723903Family d.58.4.12: Hypothetical protein YdhR [117940] (1 protein)
  6. 723904Protein Hypothetical protein YdhR [117941] (1 species)
  7. 723905Species Escherichia coli [TaxId:562] [117942] (3 PDB entries)
  8. 723907Domain d2hiqb1: 2hiq B:9-104 [136530]
    automatically matched to d1wd6a_

Details for d2hiqb1

PDB Entry: 2hiq (more details), 2 Å

PDB Description: Crystal structure of JW1657 from Escherichia coli
PDB Compounds: (B:) Hypothetical protein ydhR

SCOP Domain Sequences for d2hiqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hiqb1 d.58.4.12 (B:9-104) Hypothetical protein YdhR {Escherichia coli [TaxId: 562]}
atllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggiylftdeks
alaylekhtarlknlgveevvakvfdvneplsqinq

SCOP Domain Coordinates for d2hiqb1:

Click to download the PDB-style file with coordinates for d2hiqb1.
(The format of our PDB-style files is described here.)

Timeline for d2hiqb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hiqa1