![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.12: Hypothetical protein YdhR [117940] (2 proteins) automatically mapped to Pfam PF08803 |
![]() | Protein Hypothetical protein YdhR [117941] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [117942] (3 PDB entries) Uniprot P77225 |
![]() | Domain d2hiqb_: 2hiq B: [136530] automated match to d1wd6a_ |
PDB Entry: 2hiq (more details), 2 Å
SCOPe Domain Sequences for d2hiqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hiqb_ d.58.4.12 (B:) Hypothetical protein YdhR {Escherichia coli [TaxId: 562]} atllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggiylftdeks alaylekhtarlknlgveevvakvfdvneplsqinq
Timeline for d2hiqb_: