SCOPe 2.06: Domain d2hiqa_: 2hiq A:

Lineage for d2hiqa_ (2hiq A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.12: Hypothetical protein YdhR [117940] (2 proteins)
   automatically mapped to Pfam PF08803

6. Protein Hypothetical protein YdhR [117941] (1 species)

7. Species Escherichia coli [TaxId:562] [117942] (3 PDB entries)
   Uniprot P77225

8. Domain d2hiqa_: 2hiq A: [136529]
   automated match to d1wd6a_

Details for d2hiqa_

PDB Entry: 2hiq, 2 Å

PDB Description: Crystal structure of JW1657 from Escherichia coli

PDB Compounds: (A:) Hypothetical protein ydhR

SCOPe Domain Sequences for d2hiqa_:

Sequence; same for both SEQRES and ATOM records:

>d2hiqa_ d.58.4.12 (A:) Hypothetical protein YdhR {Escherichia coli [TaxId: 562]}
atllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggiylftdeks
alaylekhtarlknlgveevvakvfdvneplsqinq

Timeline for d2hiqa_:

• d2hiqa_ first appeared in SCOP 1.73, called d2hiqa1
  
• d2hiqa_ appears in SCOPe 2.05
  
• d2hiqa_ appears in SCOPe 2.07
  
• d2hiqa_ appears in the current release, SCOPe 2.08