| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
| Family d.58.4.12: Hypothetical protein YdhR [117940] (2 proteins) |
| Protein Hypothetical protein YdhR [117941] (1 species) |
| Species Escherichia coli [TaxId:562] [117942] (3 PDB entries) Uniprot P77225 |
| Domain d2hiqa_: 2hiq A: [136529] automated match to d1wd6a_ |
PDB Entry: 2hiq (more details), 2 Å
SCOPe Domain Sequences for d2hiqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hiqa_ d.58.4.12 (A:) Hypothetical protein YdhR {Escherichia coli [TaxId: 562]}
atllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggiylftdeks
alaylekhtarlknlgveevvakvfdvneplsqinq
Timeline for d2hiqa_: