Lineage for d2hiqa_ (2hiq A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1204251Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1204442Family d.58.4.12: Hypothetical protein YdhR [117940] (2 proteins)
  6. 1204443Protein Hypothetical protein YdhR [117941] (1 species)
  7. 1204444Species Escherichia coli [TaxId:562] [117942] (3 PDB entries)
    Uniprot P77225
  8. 1204445Domain d2hiqa_: 2hiq A: [136529]
    automated match to d1wd6a_

Details for d2hiqa_

PDB Entry: 2hiq (more details), 2 Å

PDB Description: Crystal structure of JW1657 from Escherichia coli
PDB Compounds: (A:) Hypothetical protein ydhR

SCOPe Domain Sequences for d2hiqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hiqa_ d.58.4.12 (A:) Hypothetical protein YdhR {Escherichia coli [TaxId: 562]}
atllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggiylftdeks
alaylekhtarlknlgveevvakvfdvneplsqinq

SCOPe Domain Coordinates for d2hiqa_:

Click to download the PDB-style file with coordinates for d2hiqa_.
(The format of our PDB-style files is described here.)

Timeline for d2hiqa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hiqb_