Lineage for d2hibx_ (2hib X:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002237Family d.169.1.7: Sulfatase-modifying factor-like [143959] (3 proteins)
    Pfam PF03781 (DUF323); fold decorated with many additional structures; C-alpha-formyglycine-generating enzyme
  6. 3002247Protein automated matches [190427] (1 species)
    not a true protein
  7. 3002248Species Human (Homo sapiens) [TaxId:9606] [187317] (11 PDB entries)
  8. 3002258Domain d2hibx_: 2hib X: [136527]
    automated match to d1y1ex1
    complexed with ca, iod; mutant

Details for d2hibx_

PDB Entry: 2hib (more details), 2 Å

PDB Description: human formylglycine generating enzyme, c336s mutant, iodide co- crystallization
PDB Compounds: (X:) Sulfatase-modifying factor 1

SCOPe Domain Sequences for d2hibx_:

Sequence, based on SEQRES records: (download)

>d2hibx_ d.169.1.7 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lahskmvpipagvftmgtddpqikqdgeaparrvtidafymdayevsntefekfvnstgy
lteaekfgdsfvfegmlseqvktniqqavaaapwwlpvkganwrhpegpdstilhrpdhp
vlhvswndavayctwagkrlpteaeweyscrgglhnrlfpwgnklqpkgqhyaniwqgef
pvtntgedgfqgtapvdafppngyglynivgnawewtsdwwtvhhsveetlnpkgppsgk
drvkkggsymshrsycyryrcaarsqntpdssasnlgfrcaadrlp

Sequence, based on observed residues (ATOM records): (download)

>d2hibx_ d.169.1.7 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lahskmvpipagvftmgtddpqikqdgeaparrvtidafymdayevsntefekfvnstgy
lteaekfgdsfvfegmlaaapwwlpvkganwrhpegpdstilhrpdhpvlhvswndavay
ctwagkrlpteaeweyscrgglhnrlfpwgnklqpkgqhyaniwqgefpvtntgedgfqg
tapvdafppngyglynivgnawewtsdwwtvhhsveetlnpkgppsgkdrvkkggsymsh
rsycyryrcaarsqntpdssasnlgfrcaadrlp

SCOPe Domain Coordinates for d2hibx_:

Click to download the PDB-style file with coordinates for d2hibx_.
(The format of our PDB-style files is described here.)

Timeline for d2hibx_: