Lineage for d2hi3a_ (2hi3 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691970Protein automated matches [190360] (3 species)
    not a true protein
  7. 2691997Species Mouse (Mus musculus) [TaxId:10090] [255210] (1 PDB entry)
  8. 2691998Domain d2hi3a_: 2hi3 A: [136522]
    automated match to d1uhsa_

Details for d2hi3a_

PDB Entry: 2hi3 (more details)

PDB Description: solution structure of the homeodomain-only protein hop
PDB Compounds: (A:) Homeodomain-only protein

SCOPe Domain Sequences for d2hi3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hi3a_ a.4.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
msaqtvsgptedqveileynfnkvnkhpdpttlcliaaeaglteeqtqkwfkqrlaewrr
seglpsecrsvtd

SCOPe Domain Coordinates for d2hi3a_:

Click to download the PDB-style file with coordinates for d2hi3a_.
(The format of our PDB-style files is described here.)

Timeline for d2hi3a_: