![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
![]() | Protein automated matches [190360] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [255210] (1 PDB entry) |
![]() | Domain d2hi3a_: 2hi3 A: [136522] automated match to d1uhsa_ |
PDB Entry: 2hi3 (more details)
SCOPe Domain Sequences for d2hi3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hi3a_ a.4.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} msaqtvsgptedqveileynfnkvnkhpdpttlcliaaeaglteeqtqkwfkqrlaewrr seglpsecrsvtd
Timeline for d2hi3a_: