Lineage for d2hhwa2 (2hhw A:469-876)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 743030Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 743031Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 743032Family e.8.1.1: DNA polymerase I [56673] (4 proteins)
  6. 743033Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 743034Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [56677] (42 PDB entries)
  8. 743050Domain d2hhwa2: 2hhw A:469-876 [136517]
    Other proteins in same PDB: d2hhwa1, d2hhwd1
    automatically matched to d1l3sa2
    complexed with 23t, 6og, ddg, mn, so4, suc; mutant

Details for d2hhwa2

PDB Entry: 2hhw (more details), 1.88 Å

PDB Description: ddttp:o6-methyl-guanine pair in the polymerase active site, in the closed conformation
PDB Compounds: (A:) DNA polymerase I

SCOP Domain Sequences for d2hhwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhwa2 e.8.1.1 (A:469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}
eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni
nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi
egllkvvrpatkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl
ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav
nygivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh
rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv
hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak

SCOP Domain Coordinates for d2hhwa2:

Click to download the PDB-style file with coordinates for d2hhwa2.
(The format of our PDB-style files is described here.)

Timeline for d2hhwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hhwa1