Lineage for d2hhua1 (2hhu A:298-468)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1373755Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1374321Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1374442Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 1374443Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (44 PDB entries)
    Uniprot Q45458 298-876 # 88% sequence identity ! Uniprot Q5KWC1 299-878 # 99% sequence identity; Geobacillus kaustophilus TaxID:1462
  8. 1374454Domain d2hhua1: 2hhu A:298-468 [136512]
    Other proteins in same PDB: d2hhua2
    automatically matched to d1l3sa1
    protein/DNA complex; complexed with dcp, mg, so4, suc

Details for d2hhua1

PDB Entry: 2hhu (more details), 1.8 Å

PDB Description: c:o6-methyl-guanine in the polymerase postinsertion site (-1 basepair position)
PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d2hhua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhua1 c.55.3.5 (A:298-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}
kmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpqf
vawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakmk
qyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

SCOPe Domain Coordinates for d2hhua1:

Click to download the PDB-style file with coordinates for d2hhua1.
(The format of our PDB-style files is described here.)

Timeline for d2hhua1: