SCOP 1.73: Domain d2hhqa1: 2hhq A:298-468

Lineage for d2hhqa1 (2hhq A:298-468)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (12 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (14 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (42 PDB entries)

8. Domain d2hhqa1: 2hhq A:298-468 [136506]
   Other proteins in same PDB: d2hhqa2
   automatically matched to d1l3sa1
   complexed with 6og, mg, so4, suc

Details for d2hhqa1

PDB Entry: 2hhq, 1.8 Å

PDB Description: o6-methyl-guanine:t pair in the polymerase-10 basepair position

PDB Compounds: (A:) DNA polymerase I

SCOP Domain Sequences for d2hhqa1:

Sequence; same for both SEQRES and ATOM records:

>d2hhqa1 c.55.3.5 (A:298-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}
kmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpqf
vawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakmk
qyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

Timeline for d2hhqa1:

• d2hhqa1 is new in SCOP 1.73
  
• d2hhqa1 appears in SCOP 1.75
  
• d2hhqa1 appears in the current release, SCOPe 2.08