Lineage for d2hhpa3 (2hhp A:352-530)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953807Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) (S)
  5. 2953808Family d.58.16.1: Poly(A) polymerase, PAP, C-terminal domain [55004] (1 protein)
    automatically mapped to Pfam PF04926
  6. 2953809Protein Poly(A) polymerase, PAP, C-terminal domain [55005] (2 species)
  7. 2953810Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55006] (5 PDB entries)
  8. 2953811Domain d2hhpa3: 2hhp A:352-530 [136505]
    Other proteins in same PDB: d2hhpa1, d2hhpa2
    automated match to d1fa0a1
    complexed with flc, mg

Details for d2hhpa3

PDB Entry: 2hhp (more details), 1.8 Å

PDB Description: Structure of yeast poly(A) polymerase in a closed conformation.
PDB Compounds: (A:) poly(a) polymerase

SCOPe Domain Sequences for d2hhpa3:

Sequence, based on SEQRES records: (download)

>d2hhpa3 d.58.16.1 (A:352-530) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes
syccpteddyemiqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfn
ienkkekvdihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdenekrps

Sequence, based on observed residues (ATOM records): (download)

>d2hhpa3 d.58.16.1 (A:352-530) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes
syccpteddyemiqdkygshktetalnalkpkaylstmyigldfnkekvdihipctefvn
lcrsfnedygdhkvfnlalrfvkgydlpdevfdenekrps

SCOPe Domain Coordinates for d2hhpa3:

Click to download the PDB-style file with coordinates for d2hhpa3.
(The format of our PDB-style files is described here.)

Timeline for d2hhpa3: