Lineage for d2hhpa2 (2hhp A:4-201)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740075Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 740076Superfamily d.218.1: Nucleotidyltransferase [81301] (11 families) (S)
  5. 740245Family d.218.1.3: Poly(A) polymerase, PAP, N-terminal domain [81589] (1 protein)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543
  6. 740246Protein Poly(A) polymerase, PAP, N-terminal domain [81588] (2 species)
  7. 740247Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81586] (3 PDB entries)
  8. 740248Domain d2hhpa2: 2hhp A:4-201 [136504]
    Other proteins in same PDB: d2hhpa1, d2hhpa3
    automatically matched to d1fa0b4
    complexed with flc, mg

Details for d2hhpa2

PDB Entry: 2hhp (more details), 1.8 Å

PDB Description: Structure of yeast poly(A) polymerase in a closed conformation.
PDB Compounds: (A:) poly(a) polymerase

SCOP Domain Sequences for d2hhpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhpa2 d.218.1.3 (A:4-201) Poly(A) polymerase, PAP, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qkvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqrfv
yevskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfdsl
lrerkeldeiapvpdafvpiikikfsgisidlicarldqpqvplsltlsdknllrnldek
dlralngtrvtdeilelv

SCOP Domain Coordinates for d2hhpa2:

Click to download the PDB-style file with coordinates for d2hhpa2.
(The format of our PDB-style files is described here.)

Timeline for d2hhpa2: