![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily) core: 5-helical bundle; up-and-down; right-handed twist |
![]() | Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) ![]() this domain follows the catalytic nucleotidyltransferase domain |
![]() | Family a.160.1.1: Poly(A) polymerase, PAP, middle domain [81630] (1 protein) |
![]() | Protein Poly(A) polymerase, PAP, middle domain [81629] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81628] (5 PDB entries) |
![]() | Domain d2hhpa1: 2hhp A:202-351 [136503] Other proteins in same PDB: d2hhpa2, d2hhpa3 automated match to d2q66a1 complexed with flc, mg |
PDB Entry: 2hhp (more details), 1.8 Å
SCOPe Domain Sequences for d2hhpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hhpa1 a.160.1.1 (A:202-351) Poly(A) polymerase, PAP, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pkpnvfrialraiklwaqrravyanifgfpggvawamlvaricqlypnacsavilnrffi ilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrmpvitpaypsmcathnitestk kvilqefvrgvqitndifsnkkswanlfek
Timeline for d2hhpa1: