SCOPe 2.07: Domain d2hhnb_: 2hhn B:

Lineage for d2hhnb_ (2hhn B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin S [82566] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82567] (28 PDB entries)

8. Domain d2hhnb_: 2hhn B: [136502]
   automated match to d1ms6a_
   complexed with gnq, so4

Details for d2hhnb_

PDB Entry: 2hhn, 1.55 Å

PDB Description: cathepsin s in complex with non covalent arylaminoethyl amide.

PDB Compounds: (B:) cathepsin S

SCOPe Domain Sequences for d2hhnb_:

Sequence; same for both SEQRES and ATOM records:

>d2hhnb_ d.3.1.1 (B:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei

Timeline for d2hhnb_:

• d2hhnb_ first appeared in SCOP 1.73, called d2hhnb1
  
• d2hhnb_ appears in SCOPe 2.06
  
• d2hhnb_ appears in the current release, SCOPe 2.08