SCOPe 2.07: Domain d2hhkm_: 2hhk M:

Lineage for d2hhkm_ (2hhk M:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (14 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [186985] (32 PDB entries)

8. Domain d2hhkm_: 2hhk M: [136500]
   Other proteins in same PDB: d2hhkh1, d2hhkh2
   automated match to d1ystm_
   complexed with bcl, bph, cdl, cl, fe, gol, k, lda, pgk, pgt, po4, u10

Details for d2hhkm_

PDB Entry: 2hhk, 2.5 Å

PDB Description: reaction centre from rhodobacter sphaeroides strain r-26.1 complexed with dibrominated phosphatidylglycerol

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d2hhkm_:

Sequence; same for both SEQRES and ATOM records:

>d2hhkm_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d2hhkm_:

• d2hhkm_ first appeared in SCOP 1.73, called d2hhkm1
  
• d2hhkm_ appears in SCOPe 2.06
  
• d2hhkm_ appears in the current release, SCOPe 2.08