SCOP 1.73: Domain d2hhkl1: 2hhk L:1-281

Lineage for d2hhkl1 (2hhk L:1-281)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (50 PDB entries)

8. Domain d2hhkl1: 2hhk L:1-281 [136499]
   Other proteins in same PDB: d2hhkm1
   automatically matched to d1aigl_
   complexed with bcl, bph, cdl, cl, fe, gol, k, lda, pgk, pgt, po4, u10

Details for d2hhkl1

PDB Entry: 2hhk, 2.5 Å

PDB Description: reaction centre from rhodobacter sphaeroides strain r-26.1 complexed with dibrominated phosphatidylglycerol

PDB Compounds: (L:) reaction center protein l chain

SCOP Domain Sequences for d2hhkl1:

Sequence; same for both SEQRES and ATOM records:

>d2hhkl1 f.26.1.1 (L:1-281) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d2hhkl1:

• d2hhkl1 is new in SCOP 1.73
  
• d2hhkl1 appears in SCOP 1.75
  
• d2hhkl1 appears in the current release, SCOPe 2.08, called d2hhkl_