SCOP 1.75: Domain d2hhhr1: 2hhh R:16-88

Lineage for d2hhhr1 (2hhh R:16-88)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (2 species)

7. Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
   Uniprot P80382

8. Domain d2hhhr1: 2hhh R:16-88 [136494]
   Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhh1, d2hhhi1, d2hhhj1, d2hhhk1, d2hhhl1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhs1, d2hhht1, d2hhhu1
   automatically matched to d1i94r_
   complexed with ksg

Details for d2hhhr1

PDB Entry: 2hhh, 3.35 Å

PDB Description: Crystal structure of kasugamycin bound to the 30S ribosomal subunit

PDB Compounds: (R:) 30S ribosomal protein S18

SCOP Domain Sequences for d2hhhr1:

Sequence; same for both SEQRES and ATOM records:

>d2hhhr1 a.4.8.1 (R:16-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

Timeline for d2hhhr1:

• d2hhhr1 first appeared in SCOP 1.73
  
• d2hhhr1 appears in SCOPe 2.01
  
• d2hhhr1 appears in the current release, SCOPe 2.08