Lineage for d2hhhr1 (2hhh R:16-88)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 763283Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 763284Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 763285Protein Ribosomal protein S18 [46913] (2 species)
  7. 763311Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 763338Domain d2hhhr1: 2hhh R:16-88 [136494]
    Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhh1, d2hhhi1, d2hhhj1, d2hhhk1, d2hhhl1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhs1, d2hhht1, d2hhhu1
    automatically matched to d1i94r_
    complexed with ksg

Details for d2hhhr1

PDB Entry: 2hhh (more details), 3.35 Å

PDB Description: Crystal structure of kasugamycin bound to the 30S ribosomal subunit
PDB Compounds: (R:) 30S ribosomal protein S18

SCOP Domain Sequences for d2hhhr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhhr1 a.4.8.1 (R:16-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOP Domain Coordinates for d2hhhr1:

Click to download the PDB-style file with coordinates for d2hhhr1.
(The format of our PDB-style files is described here.)

Timeline for d2hhhr1: