Lineage for d2hhhp1 (2hhh P:1-83)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857884Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 857885Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 857886Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 857887Protein Ribosomal protein S16 [54567] (3 species)
  7. 857917Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
    Uniprot P80379
  8. 857939Domain d2hhhp1: 2hhh P:1-83 [136492]
    Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhh1, d2hhhi1, d2hhhj1, d2hhhk1, d2hhhl1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhq1, d2hhhr1, d2hhhs1, d2hhht1, d2hhhu1
    automatically matched to d1emwa_
    complexed with ksg

Details for d2hhhp1

PDB Entry: 2hhh (more details), 3.35 Å

PDB Description: Crystal structure of kasugamycin bound to the 30S ribosomal subunit
PDB Compounds: (P:) 30S ribosomal protein S16

SCOP Domain Sequences for d2hhhp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhhp1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOP Domain Coordinates for d2hhhp1:

Click to download the PDB-style file with coordinates for d2hhhp1.
(The format of our PDB-style files is described here.)

Timeline for d2hhhp1: