Lineage for d2hhhn1 (2hhh N:2-61)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750235Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 750236Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) (S)
  5. 750502Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 750503Protein Ribosomal protein S14 [57753] (1 species)
  7. 750504Species Thermus thermophilus [TaxId:274] [57754] (36 PDB entries)
  8. 750524Domain d2hhhn1: 2hhh N:2-61 [136490]
    Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhh1, d2hhhi1, d2hhhj1, d2hhhk1, d2hhhl1, d2hhhm1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhr1, d2hhhs1, d2hhht1
    automatically matched to d1fjgn_
    complexed with ksg

Details for d2hhhn1

PDB Entry: 2hhh (more details), 3.35 Å

PDB Description: Crystal structure of kasugamycin bound to the 30S ribosomal subunit
PDB Compounds: (N:) 30S ribosomal protein S14

SCOP Domain Sequences for d2hhhn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhhn1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOP Domain Coordinates for d2hhhn1:

Click to download the PDB-style file with coordinates for d2hhhn1.
(The format of our PDB-style files is described here.)

Timeline for d2hhhn1: