Lineage for d2hhhm1 (2hhh M:2-126)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1284575Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 1284576Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 1284577Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
    automatically mapped to Pfam PF00416
  6. 1284578Protein Ribosomal protein S13 [46948] (2 species)
  7. 1284606Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries)
    Uniprot P80377
  8. 1284631Domain d2hhhm1: 2hhh M:2-126 [136489]
    Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhh1, d2hhhi1, d2hhhj1, d2hhhk1, d2hhhl1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhr1, d2hhhs1, d2hhht1, d2hhhu1
    automatically matched to d1fjgm_
    complexed with ksg

Details for d2hhhm1

PDB Entry: 2hhh (more details), 3.35 Å

PDB Description: Crystal structure of kasugamycin bound to the 30S ribosomal subunit
PDB Compounds: (M:) 30S ribosomal protein S13

SCOPe Domain Sequences for d2hhhm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhhm1 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

SCOPe Domain Coordinates for d2hhhm1:

Click to download the PDB-style file with coordinates for d2hhhm1.
(The format of our PDB-style files is described here.)

Timeline for d2hhhm1: