Class a: All alpha proteins [46456] (284 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension automatically mapped to Pfam PF00416 |
Protein Ribosomal protein S13 [46948] (2 species) |
Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries) Uniprot P80377 |
Domain d2hhhm1: 2hhh M:2-126 [136489] Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhh1, d2hhhi1, d2hhhj1, d2hhhk1, d2hhhl1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhr1, d2hhhs1, d2hhht1, d2hhhu1 automatically matched to d1fjgm_ complexed with ksg |
PDB Entry: 2hhh (more details), 3.35 Å
SCOPe Domain Sequences for d2hhhm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hhhm1 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]} ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk kaprk
Timeline for d2hhhm1: