Lineage for d2hhhk1 (2hhh K:11-129)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1860419Superfamily c.55.4: Translational machinery components [53137] (3 families) (S)
  5. 1860420Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 1860510Protein Ribosomal protein S11 [53141] (2 species)
  7. 1860536Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries)
    Uniprot P80376
  8. 1860561Domain d2hhhk1: 2hhh K:11-129 [136487]
    Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhh1, d2hhhi1, d2hhhj1, d2hhhl1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhr1, d2hhhs1, d2hhht1, d2hhhu1
    automatically matched to d1i94k_
    complexed with ksg

Details for d2hhhk1

PDB Entry: 2hhh (more details), 3.35 Å

PDB Description: Crystal structure of kasugamycin bound to the 30S ribosomal subunit
PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d2hhhk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhhk1 c.55.4.1 (K:11-129) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

SCOPe Domain Coordinates for d2hhhk1:

Click to download the PDB-style file with coordinates for d2hhhk1.
(The format of our PDB-style files is described here.)

Timeline for d2hhhk1: