SCOP 1.73: Domain d2hhhk1: 2hhh K:11-129

Lineage for d2hhhk1 (2hhh K:11-129)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (2 families)

5. Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)

6. Protein Ribosomal protein S11 [53141] (1 species)

7. Species Thermus thermophilus [TaxId:274] [53142] (37 PDB entries)

8. Domain d2hhhk1: 2hhh K:11-129 [136487]
   Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhh1, d2hhhi1, d2hhhj1, d2hhhl1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhr1, d2hhhs1, d2hhht1
   automatically matched to d1i94k_
   complexed with ksg

Details for d2hhhk1

PDB Entry: 2hhh, 3.35 Å

PDB Description: Crystal structure of kasugamycin bound to the 30S ribosomal subunit

PDB Compounds: (K:) 30S ribosomal protein S11

SCOP Domain Sequences for d2hhhk1:

Sequence; same for both SEQRES and ATOM records:

>d2hhhk1 c.55.4.1 (K:11-129) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

Timeline for d2hhhk1:

• d2hhhk1 is new in SCOP 1.73
  
• d2hhhk1 appears in SCOP 1.75
  
• d2hhhk1 appears in the current release, SCOPe 2.08