SCOPe 2.01: Domain d2hhhc1: 2hhh C:2-106

Lineage for d2hhhc1 (2hhh C:2-106)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)

7. Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries)
   Uniprot P80372

8. Domain d2hhhc1: 2hhh C:2-106 [136477]
   Other proteins in same PDB: d2hhhb1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhh1, d2hhhi1, d2hhhj1, d2hhhk1, d2hhhl1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhr1, d2hhhs1, d2hhht1, d2hhhu1
   automatically matched to d1fjgc1
   complexed with ksg

Details for d2hhhc1

PDB Entry: 2hhh, 3.35 Å

PDB Description: Crystal structure of kasugamycin bound to the 30S ribosomal subunit

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2hhhc1:

Sequence; same for both SEQRES and ATOM records:

>d2hhhc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

Timeline for d2hhhc1:

• d2hhhc1 first appeared in SCOP 1.73
  
• d2hhhc1 appears in SCOP 1.75
  
• d2hhhc1 appears in SCOPe 2.02
  
• d2hhhc1 appears in the current release, SCOPe 2.08