Lineage for d2hhfb_ (2hhf B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018494Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 3018495Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 3018496Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)
  6. 3018502Protein Branched-chain aminoacid aminotransferase [56757] (2 species)
  7. 3018522Species Human (Homo sapiens), mitochondrial [TaxId:9606] [64508] (26 PDB entries)
  8. 3018549Domain d2hhfb_: 2hhf B: [136475]
    automated match to d1ekfa_
    complexed with epe, plp

Details for d2hhfb_

PDB Entry: 2hhf (more details), 1.8 Å

PDB Description: x-ray crystal structure of oxidized human mitochondrial branched chain aminotransferase (hbcatm)
PDB Compounds: (B:) Branched-chain-amino-acid aminotransferase, mitochondrial

SCOPe Domain Sequences for d2hhfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhfb_ e.17.1.1 (B:) Branched-chain aminoacid aminotransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
asssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnlt
lhpassslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellec
irrlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvt
pvslladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgt
mnifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllral
eegrvrevfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahe
wmfpv

SCOPe Domain Coordinates for d2hhfb_:

Click to download the PDB-style file with coordinates for d2hhfb_.
(The format of our PDB-style files is described here.)

Timeline for d2hhfb_: