SCOPe 2.08: Domain d2hh0l2: 2hh0 L:153-271

Lineage for d2hh0l2 (2hh0 L:153-271)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d2hh0l2: 2hh0 L:153-271 [136465]
   Other proteins in same PDB: d2hh0h1, d2hh0h2, d2hh0l1
   chimera with human V domain

Details for d2hh0l2

PDB Entry: 2hh0, 2.85 Å

PDB Description: structure of an anti-prp fab, p-clone, in complex with its cognate bovine peptide epitope.

PDB Compounds: (L:) Light Chain, P-Clone Fab, Chimera

SCOPe Domain Sequences for d2hh0l2:

Sequence; same for both SEQRES and ATOM records:

>d2hh0l2 b.1.1.2 (L:153-271) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d2hh0l2:

• d2hh0l2 first appeared in SCOP 1.73
  
• d2hh0l2 appears in SCOPe 2.07