SCOP 1.73: Domain d2hh0l1: 2hh0 L:2-149

Lineage for d2hh0l1 (2hh0 L:2-149)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)

8. Domain d2hh0l1: 2hh0 L:2-149 [136464]
   Other proteins in same PDB: d2hh0h1, d2hh0h2, d2hh0l2
   chimera with human C domain
   mutant

Details for d2hh0l1

PDB Entry: 2hh0, 2.85 Å

PDB Description: structure of an anti-prp fab, p-clone, in complex with its cognate bovine peptide epitope.

PDB Compounds: (L:) Light Chain, P-Clone Fab, Chimera

SCOP Domain Sequences for d2hh0l1:

Sequence; same for both SEQRES and ATOM records:

>d2hh0l1 b.1.1.1 (L:2-149) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
lvmtqtpsslsaslgervsltcrasqdignnlnwiqqkpdgtikrliyatssldsgvpkr
fsgsrsgsdysltisslesedfadyyclqhdtfpltfgggtkleikr

Timeline for d2hh0l1:

• d2hh0l1 is new in SCOP 1.73
  
• d2hh0l1 appears in SCOP 1.75
  
• d2hh0l1 appears in the current release, SCOPe 2.08